| Class b: All beta proteins [48724] (144 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins) |
| Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
| Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50471] (1 PDB entry) |
| Domain d1d2ed2: 1d2e D:349-451 [25744] Other proteins in same PDB: d1d2ea1, d1d2ea3, d1d2eb1, d1d2eb3, d1d2ec1, d1d2ec3, d1d2ed1, d1d2ed3 |
PDB Entry: 1d2e (more details), 1.94 Å
SCOP Domain Sequences for d1d2ed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ed2 b.44.1.1 (D:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial}
hqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltl
ilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikw
Timeline for d1d2ed2: