Lineage for d1d2ed2 (1d2e D:349-451)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464914Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464915Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 464916Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins)
  6. 464928Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 464929Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50471] (1 PDB entry)
  8. 464933Domain d1d2ed2: 1d2e D:349-451 [25744]
    Other proteins in same PDB: d1d2ea1, d1d2ea3, d1d2eb1, d1d2eb3, d1d2ec1, d1d2ec3, d1d2ed1, d1d2ed3

Details for d1d2ed2

PDB Entry: 1d2e (more details), 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp

SCOP Domain Sequences for d1d2ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ed2 b.44.1.1 (D:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial}
hqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltl
ilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikw

SCOP Domain Coordinates for d1d2ed2:

Click to download the PDB-style file with coordinates for d1d2ed2.
(The format of our PDB-style files is described here.)

Timeline for d1d2ed2: