Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.1: COMT-like [53336] (4 proteins) |
Protein Catechol O-methyltransferase, COMT [53337] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [53338] (87 PDB entries) |
Domain d4p7gc_: 4p7g C: [257439] automated match to d1h1da_ complexed with k, po4 |
PDB Entry: 4p7g (more details), 2.58 Å
SCOPe Domain Sequences for d4p7gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p7gc_ c.66.1.1 (C:) Catechol O-methyltransferase, COMT {Norway rat (Rattus norvegicus) [TaxId: 10116]} gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl vlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqd lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla yvrgsssfecthyssyleymkvvdglekaiyqgp
Timeline for d4p7gc_: