Lineage for d1d2ec2 (1d2e C:349-451)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14748Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)
  4. 14749Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) (S)
  5. 14750Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)
  6. 14755Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 14756Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50471] (1 PDB entry)
  8. 14759Domain d1d2ec2: 1d2e C:349-451 [25743]
    Other proteins in same PDB: d1d2ea1, d1d2ea3, d1d2eb1, d1d2eb3, d1d2ec1, d1d2ec3, d1d2ed1, d1d2ed3

Details for d1d2ec2

PDB Entry: 1d2e (more details), 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp

SCOP Domain Sequences for d1d2ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ec2 b.44.1.1 (C:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial}
hqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltl
ilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikw

SCOP Domain Coordinates for d1d2ec2:

Click to download the PDB-style file with coordinates for d1d2ec2.
(The format of our PDB-style files is described here.)

Timeline for d1d2ec2: