SCOPe 2.05: Domain d4p49a2: 4p49 A:121-243

Lineage for d4p49a2 (4p49 A:121-243)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (18 PDB entries)

8. Domain d4p49a2: 4p49 A:121-243 [257429]
   automated match to d4ouoa2
   complexed with act, so4

Details for d4p49a2

PDB Entry: 4p49, 1.4 Å

PDB Description: the structure of a chicken anti-prostate specific antigen scfv

PDB Compounds: (A:) Antibody scFv B8

SCOPe Domain Sequences for d4p49a2:

Sequence; same for both SEQRES and ATOM records:

>d4p49a2 b.1.1.0 (A:121-243) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
avtldesggglqtpggalslvckasgftfssyamgwvrqapgkglewvagisddgdsyis
yatavkgratisrdngqstvrlqlnnlraedtatyycarshcsgcrnaalidawghgtev
ivs

Timeline for d4p49a2:

• d4p49a2 first appeared in SCOPe 2.04
  
• d4p49a2 appears in SCOPe 2.06
  
• d4p49a2 appears in the current release, SCOPe 2.08