Lineage for d4p48a1 (4p48 A:1-110)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (26 species)
    not a true protein
  7. 2355240Species Chicken (Gallus gallus) [TaxId:9031] [188287] (21 PDB entries)
  8. 2355247Domain d4p48a1: 4p48 A:1-110 [257426]
    automated match to d4ouoa1

Details for d4p48a1

PDB Entry: 4p48 (more details), 1.35 Å

PDB Description: the structure of a chicken anti-cardiac troponin i scfv
PDB Compounds: (A:) Antibody scFv 180

SCOPe Domain Sequences for d4p48a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p48a1 b.1.1.0 (A:1-110) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
altqpssvsanpggtveitcsgggryydgsyyygwyqqkspgsapvtviyentkrpsnip
srfsgsksgstatltitgvraedeavyycgsaddnmnptifgagttltvl

SCOPe Domain Coordinates for d4p48a1:

Click to download the PDB-style file with coordinates for d4p48a1.
(The format of our PDB-style files is described here.)

Timeline for d4p48a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4p48a2