Class b: All beta proteins [48724] (174 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50471] (2 PDB entries) Uniprot P49410 56-452 |
Domain d1d2eb2: 1d2e B:349-451 [25742] Other proteins in same PDB: d1d2ea1, d1d2ea3, d1d2eb1, d1d2eb3, d1d2ec1, d1d2ec3, d1d2ed1, d1d2ed3 protein/RNA complex; complexed with gdp, mg |
PDB Entry: 1d2e (more details), 1.94 Å
SCOPe Domain Sequences for d1d2eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2eb2 b.44.1.1 (B:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} hqkveaqvyiltkeeggrhkpfvshfmpvmfsltwdmacriilppgkelampgedlkltl ilrqpmilekgqrftlrdgnrtigtglvtdtpamteedknikw
Timeline for d1d2eb2: