Lineage for d4p46a2 (4p46 A:112-201)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753258Domain d4p46a2: 4p46 A:112-201 [257414]
    Other proteins in same PDB: d4p46a1, d4p46b1, d4p46c1, d4p46c2, d4p46d1, d4p46d2
    automated match to d2bnqd2

Details for d4p46a2

PDB Entry: 4p46 (more details), 2.85 Å

PDB Description: j809.b5 y31a tcr bound to iab3k
PDB Compounds: (A:) J809.B5 TCR Y31A alpha chain (Va2.8)

SCOPe Domain Sequences for d4p46a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p46a2 b.1.1.2 (A:112-201) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
yiqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4p46a2:

Click to download the PDB-style file with coordinates for d4p46a2.
(The format of our PDB-style files is described here.)

Timeline for d4p46a2: