SCOPe 2.06: Domain d4p3ya2: 4p3y A:206-297

Lineage for d4p3ya2 (4p3y A:206-297)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (26 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [257409] (2 PDB entries)

8. Domain d4p3ya2: 4p3y A:206-297 [257410]
   Other proteins in same PDB: d4p3ya1, d4p3ya3, d4p3yb1, d4p3yb2
   automated match to d1efca1
   complexed with gdp, gol, mg

Details for d4p3ya2

PDB Entry: 4p3y, 2.15 Å

PDB Description: crystal structure of acinetobacter baumannii dsba in complex with ef- tu

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d4p3ya2:

Sequence; same for both SEQRES and ATOM records:

>d4p3ya2 b.43.3.0 (A:206-297) automated matches {Escherichia coli [TaxId: 469008]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

Timeline for d4p3ya2:

• d4p3ya2 first appeared in SCOPe 2.04
  
• d4p3ya2 appears in SCOPe 2.05
  
• d4p3ya2 appears in SCOPe 2.07
  
• d4p3ya2 appears in the current release, SCOPe 2.08