Lineage for d4p3yb_ (4p3y B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854432Species Acinetobacter baumannii [TaxId:509173] [257404] (1 PDB entry)
  8. 1854433Domain d4p3yb_: 4p3y B: [257405]
    Other proteins in same PDB: d4p3ya1, d4p3ya2, d4p3ya3
    automated match to d4k2da_
    complexed with gdp, gol, mg

Details for d4p3yb_

PDB Entry: 4p3y (more details), 2.15 Å

PDB Description: Crystal structure of Acinetobacter baumannii DsbA in complex with EF-Tu
PDB Compounds: (B:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4p3yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3yb_ c.47.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
snaagkdytvianpgkvevpgkievreffwygcphcfklephmqtwlkqipsdvrfvrtp
aamnkvweqgartyytsealgvrkrthlplfhaiqvngqqifdqasaakfftrygvpeqk
fnstynsfavtakvaesnklaqqyqltgvpavvvngkyvvqgedgkvtqvlnyliekerk
a

SCOPe Domain Coordinates for d4p3yb_:

Click to download the PDB-style file with coordinates for d4p3yb_.
(The format of our PDB-style files is described here.)

Timeline for d4p3yb_: