SCOP 1.55: Domain d1aipf2: 1aip F:313-405

Lineage for d1aipf2 (1aip F:313-405)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)

4. Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family)

5. Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus thermophilus [TaxId:274] [50470] (2 PDB entries)

8. Domain d1aipf2: 1aip F:313-405 [25740]
   Other proteins in same PDB: d1aipa1, d1aipa3, d1aipb1, d1aipb3, d1aipc_, d1aipd_, d1aipe1, d1aipe3, d1aipf1, d1aipf3, d1aipg_, d1aiph_

Details for d1aipf2

PDB Entry: 1aip, 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipf2:

Sequence; same for both SEQRES and ATOM records:

>d1aipf2 b.44.1.1 (F:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d1aipf2:

• d1aipf2 appears in SCOP 1.57
  
• d1aipf2 appears in the current release, SCOPe 2.08