Lineage for d1aipb2 (1aip B:313-405)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14748Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)
  4. 14749Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) (S)
  5. 14750Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)
  6. 14755Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 14779Species Thermus thermophilus [TaxId:274] [50470] (2 PDB entries)
  8. 14782Domain d1aipb2: 1aip B:313-405 [25738]
    Other proteins in same PDB: d1aipa1, d1aipa3, d1aipb1, d1aipb3, d1aipc_, d1aipd_, d1aipe1, d1aipe3, d1aipf1, d1aipf3, d1aipg_, d1aiph_

Details for d1aipb2

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aipb2 b.44.1.1 (B:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1aipb2:

Click to download the PDB-style file with coordinates for d1aipb2.
(The format of our PDB-style files is described here.)

Timeline for d1aipb2: