Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4ozhh2: 4ozh H:129-256 [257377] Other proteins in same PDB: d4ozhe1, d4ozhf1, d4ozhh1 automated match to d2esve2 complexed with ca, nag |
PDB Entry: 4ozh (more details), 2.8 Å
SCOPe Domain Sequences for d4ozhh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozhh2 b.1.1.2 (H:129-256) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d4ozhh2:
View in 3D Domains from other chains: (mouse over for more information) d4ozhe1, d4ozhe2, d4ozhf1, d4ozhf2 |