Lineage for d4ozhf2 (4ozh F:129-256)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517948Domain d4ozhf2: 4ozh F:129-256 [257376]
    Other proteins in same PDB: d4ozhe1, d4ozhf1, d4ozhh1
    automated match to d2esve2
    complexed with ca, nag

Details for d4ozhf2

PDB Entry: 4ozh (more details), 2.8 Å

PDB Description: s16 protein complex
PDB Compounds: (F:) T-cell receptor, s16, beta chain

SCOPe Domain Sequences for d4ozhf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozhf2 b.1.1.2 (F:129-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4ozhf2:

Click to download the PDB-style file with coordinates for d4ozhf2.
(The format of our PDB-style files is described here.)

Timeline for d4ozhf2: