Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4ozgh2: 4ozg H:130-256 [257371] Other proteins in same PDB: d4ozge1, d4ozgf1, d4ozgh1 automated match to d3of6b2 complexed with ca, nag |
PDB Entry: 4ozg (more details), 3 Å
SCOPe Domain Sequences for d4ozgh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozgh2 b.1.1.2 (H:130-256) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgra
Timeline for d4ozgh2:
View in 3D Domains from other chains: (mouse over for more information) d4ozge1, d4ozge2, d4ozgf1, d4ozgf2 |