SCOPe 2.06: Domain d1aipa2: 1aip A:313-405

Lineage for d1aipa2 (1aip A:313-405)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus thermophilus [TaxId:274] [50470] (4 PDB entries)

8. Domain d1aipa2: 1aip A:313-405 [25737]
   Other proteins in same PDB: d1aipa1, d1aipa3, d1aipb1, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe1, d1aipe3, d1aipf1, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2

Details for d1aipa2

PDB Entry: 1aip, 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1aipa2:

Sequence; same for both SEQRES and ATOM records:

>d1aipa2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d1aipa2:

• d1aipa2 first appeared (with stable ids) in SCOP 1.55
  
• d1aipa2 appears in SCOPe 2.05
  
• d1aipa2 appears in SCOPe 2.07
  
• d1aipa2 appears in the current release, SCOPe 2.08