Lineage for d4ozgf1 (4ozg F:3-129)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520329Domain d4ozgf1: 4ozg F:3-129 [257368]
    Other proteins in same PDB: d4ozge2, d4ozgf2, d4ozgh2
    automated match to d3of6c1
    complexed with ca, nag

Details for d4ozgf1

PDB Entry: 4ozg (more details), 3 Å

PDB Description: d2 protein complex
PDB Compounds: (F:) T-cell receptor, d2, beta chain

SCOPe Domain Sequences for d4ozgf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozgf1 b.1.1.0 (F:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsqspsnkvtekgkdvelrcdpisghtalywyrqslgqglefliyfqgnsapdksglps
drfsaertggsvstltiqrtqqedsavylcassfrftdtqyfgpgtrltvled

SCOPe Domain Coordinates for d4ozgf1:

Click to download the PDB-style file with coordinates for d4ozgf1.
(The format of our PDB-style files is described here.)

Timeline for d4ozgf1: