SCOPe 2.08: Domain d4ozfb1: 4ozf B:3-92

Lineage for d4ozfb1 (4ozf B:3-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d4ozfb1: 4ozf B:3-92 [257362]
   Other proteins in same PDB: d4ozfa2, d4ozfb2, d4ozfg1, d4ozfg2, d4ozfh1, d4ozfh2
   automated match to d1klub2
   complexed with nag

Details for d4ozfb1

PDB Entry: 4ozf, 2.7 Å

PDB Description: jr5.1 protein complex

PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozfb1:

Sequence; same for both SEQRES and ATOM records:

>d4ozfb1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

Timeline for d4ozfb1:

• d4ozfb1 first appeared in SCOPe 2.04
  
• d4ozfb1 appears in SCOPe 2.07