SCOPe 2.06: Domain d4ozfa1: 4ozf A:1-81

Lineage for d4ozfa1 (4ozf A:1-81)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d4ozfa1: 4ozf A:1-81 [257360]
   Other proteins in same PDB: d4ozfa2, d4ozfb2, d4ozfg1, d4ozfg2, d4ozfh1, d4ozfh2
   automated match to d1uvqa2
   complexed with nag

Details for d4ozfa1

PDB Entry: 4ozf, 2.7 Å

PDB Description: jr5.1 protein complex

PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d4ozfa1:

Sequence; same for both SEQRES and ATOM records:

>d4ozfa1 d.19.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
tniavlkhnlnslikrsnsta

Timeline for d4ozfa1:

• d4ozfa1 first appeared in SCOPe 2.04
  
• d4ozfa1 appears in SCOPe 2.05
  
• d4ozfa1 appears in SCOPe 2.07
  
• d4ozfa1 appears in the current release, SCOPe 2.08