Lineage for d4oy6a_ (4oy6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039788Species Streptomyces coelicolor [TaxId:100226] [257350] (3 PDB entries)
  8. 2039790Domain d4oy6a_: 4oy6 A: [257351]
    automated match to d4gboa_
    complexed with act, cu, na, zn

Details for d4oy6a_

PDB Entry: 4oy6 (more details), 1.29 Å

PDB Description: structure of sclpmo10b in complex with copper.
PDB Compounds: (A:) Putative secreted cellulose-binding protein

SCOPe Domain Sequences for d4oy6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oy6a_ b.1.18.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
hgsvvdpasrnygcwerwgddfqnpamadedpmcwqawqddpnamwnwnglyrngsagdf
eavvpdgqlcsggrtesgrynsldavgpwqttdvtddftvklhdqashgadyflvyvtkq
gfdpatqaltwgelqqvartgsygpsqnyeipvstsgltgrhvvytiwqashmdqtyflc
sdvdfg

SCOPe Domain Coordinates for d4oy6a_:

Click to download the PDB-style file with coordinates for d4oy6a_.
(The format of our PDB-style files is described here.)

Timeline for d4oy6a_: