SCOPe 2.06: Domain d1tuib2: 1tui B:313-405

Lineage for d1tuib2 (1tui B:313-405)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)

8. Domain d1tuib2: 1tui B:313-405 [25734]
   Other proteins in same PDB: d1tuia1, d1tuia3, d1tuib1, d1tuib3, d1tuic1, d1tuic3
   complexed with gdp, mg

Details for d1tuib2

PDB Entry: 1tui, 2.7 Å

PDB Description: intact elongation factor tu in complex with gdp

PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d1tuib2:

Sequence; same for both SEQRES and ATOM records:

>d1tuib2 b.44.1.1 (B:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d1tuib2:

• d1tuib2 first appeared (with stable ids) in SCOP 1.55
  
• d1tuib2 appears in SCOPe 2.05
  
• d1tuib2 appears in SCOPe 2.07
  
• d1tuib2 appears in the current release, SCOPe 2.08