Lineage for d1tuib2 (1tui B:313-405)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14748Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)
  4. 14749Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) (S)
  5. 14750Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)
  6. 14755Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 14770Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)
  8. 14777Domain d1tuib2: 1tui B:313-405 [25734]
    Other proteins in same PDB: d1tuia1, d1tuia3, d1tuib1, d1tuib3, d1tuic1, d1tuic3

Details for d1tuib2

PDB Entry: 1tui (more details), 2.7 Å

PDB Description: intact elongation factor tu in complex with gdp

SCOP Domain Sequences for d1tuib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuib2 b.44.1.1 (B:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1tuib2:

Click to download the PDB-style file with coordinates for d1tuib2.
(The format of our PDB-style files is described here.)

Timeline for d1tuib2: