SCOP 1.55: Domain d1tttc2: 1ttt C:313-405

Lineage for d1tttc2 (1ttt C:313-405)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)

4. Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family)

5. Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)

8. Domain d1tttc2: 1ttt C:313-405 [25732]
   Other proteins in same PDB: d1ttta1, d1ttta3, d1tttb1, d1tttb3, d1tttc1, d1tttc3

Details for d1tttc2

PDB Entry: 1ttt, 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex

SCOP Domain Sequences for d1tttc2:

Sequence; same for both SEQRES and ATOM records:

>d1tttc2 b.44.1.1 (C:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d1tttc2:

• d1tttc2 appears in SCOP 1.57
  
• d1tttc2 appears in the current release, SCOPe 2.07