Lineage for d1tttb2 (1ttt B:313-405)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669876Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669877Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 669878Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 669906Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 669926Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)
  8. 669930Domain d1tttb2: 1ttt B:313-405 [25731]
    Other proteins in same PDB: d1ttta1, d1ttta3, d1tttb1, d1tttb3, d1tttc1, d1tttc3

Details for d1tttb2

PDB Entry: 1ttt (more details), 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex
PDB Compounds: (B:) of elongation factor tu (ef-tu)

SCOP Domain Sequences for d1tttb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tttb2 b.44.1.1 (B:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1tttb2:

Click to download the PDB-style file with coordinates for d1tttb2.
(The format of our PDB-style files is described here.)

Timeline for d1tttb2: