Lineage for d4omua1 (4omu A:1-100)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890826Species Pseudomonas putida [TaxId:160488] [257299] (1 PDB entry)
  8. 2890827Domain d4omua1: 4omu A:1-100 [257300]
    Other proteins in same PDB: d4omua2
    automated match to d1nyta2
    complexed with so4

Details for d4omua1

PDB Entry: 4omu (more details), 1.65 Å

PDB Description: Crystal structure of shikimate dehydrogenase (AroE) from Pseudomonas putida
PDB Compounds: (A:) Shikimate dehydrogenase

SCOPe Domain Sequences for d4omua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4omua1 c.58.1.0 (A:1-100) automated matches {Pseudomonas putida [TaxId: 160488]}
mdqyvvfgnpighsksplihrlfaeqtgqdleyatllapldefsdcargffkqgsggnvt
vpfkeeafrlcdsltprarragavntlskladgtlqgdnt

SCOPe Domain Coordinates for d4omua1:

Click to download the PDB-style file with coordinates for d4omua1.
(The format of our PDB-style files is described here.)

Timeline for d4omua1: