Class b: All beta proteins [48724] (177 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries) |
Domain d1ttta2: 1ttt A:314-405 [25730] Other proteins in same PDB: d1ttta1, d1ttta3, d1tttb1, d1tttb3, d1tttc1, d1tttc3 protein/RNA complex; complexed with gnp, mg, phe |
PDB Entry: 1ttt (more details), 2.7 Å
SCOPe Domain Sequences for d1ttta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ttta2 b.44.1.1 (A:314-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]} tkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftve likpvaleeglrfaireggrtvgagvvtkile
Timeline for d1ttta2: