Lineage for d4om4c_ (4om4 C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259119Protein Cardiotoxin II [57334] (2 species)
  7. 2259124Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57335] (4 PDB entries)
  8. 2259127Domain d4om4c_: 4om4 C: [257292]
    automated match to d1crfa_

Details for d4om4c_

PDB Entry: 4om4 (more details), 2.74 Å

PDB Description: crystal structure of ctx a2 from taiwan cobra (naja naja atra)
PDB Compounds: (C:) cytotoxin 2

SCOPe Domain Sequences for d4om4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4om4c_ g.7.1.1 (C:) Cardiotoxin II {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkcnklvplfyktcpagknlcykmfmvsnltvpvkrgcidvcpknsalvkyvccntdrcn

SCOPe Domain Coordinates for d4om4c_:

Click to download the PDB-style file with coordinates for d4om4c_.
(The format of our PDB-style files is described here.)

Timeline for d4om4c_: