SCOP 1.73: Domain d1b23p2: 1b23 P:313-405

Lineage for d1b23p2 (1b23 P:313-405)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)

8. Domain d1b23p2: 1b23 P:313-405 [25729]
   Other proteins in same PDB: d1b23p1, d1b23p3
   complexed with aac, gnp, h2u, mg, mia, psu, s4u, so4

Details for d1b23p2

PDB Entry: 1b23, 2.6 Å

PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex

PDB Compounds: (P:) elongation factor tu

SCOP Domain Sequences for d1b23p2:

Sequence; same for both SEQRES and ATOM records:

>d1b23p2 b.44.1.1 (P:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d1b23p2:

• d1b23p2 first appeared (with stable ids) in SCOP 1.55
  
• d1b23p2 appears in SCOP 1.71
  
• d1b23p2 appears in SCOP 1.75
  
• d1b23p2 appears in the current release, SCOPe 2.08