Lineage for d1eft_2 (1eft 313-405)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464914Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464915Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 464916Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins)
  6. 464928Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 464944Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)
  8. 464946Domain d1eft_2: 1eft 313-405 [25728]
    Other proteins in same PDB: d1eft_1, d1eft_3

Details for d1eft_2

PDB Entry: 1eft (more details), 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation

SCOP Domain Sequences for d1eft_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eft_2 b.44.1.1 (313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1eft_2:

Click to download the PDB-style file with coordinates for d1eft_2.
(The format of our PDB-style files is described here.)

Timeline for d1eft_2: