Lineage for d1eft_2 (1eft 313-405)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily) Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) 
Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins) 
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) 
Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries) 
Domain d1eft_2: 1eft 313-405 [25728]
Other proteins in same PDB: d1eft_1, d1eft_3
Details for d1eft_2
PDB Entry: 1eft (more details), 2.5 Å
PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation
SCOP Domain Sequences for d1eft_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eft_2 b.44.1.1 (313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile
SCOP Domain Coordinates for d1eft_2:
Click to download the PDB-style file with coordinates for d1eft_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eft_2:
- d1eft_2 first appeared (with stable ids) in SCOP 1.55
- d1eft_2 appears in SCOP 1.59
- d1eft_2 appears in the current release, SCOPe 2.08, called d1efta2
View in 3D
