Lineage for d1d8tb2 (1d8t B:297-393)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14748Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)
  4. 14749Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) (S)
  5. 14750Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)
  6. 14755Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 14761Species Escherichia coli [TaxId:562] [50468] (4 PDB entries)
  8. 14765Domain d1d8tb2: 1d8t B:297-393 [25727]
    Other proteins in same PDB: d1d8ta1, d1d8ta3, d1d8tb1, d1d8tb3

Details for d1d8tb2

PDB Entry: 1d8t (more details), 2.35 Å

PDB Description: crystal structure of elongation factor, tu (ef-tu-mggdp) complexed with ge2270a, a thiazolyl peptide antibiotic

SCOP Domain Sequences for d1d8tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8tb2 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOP Domain Coordinates for d1d8tb2:

Click to download the PDB-style file with coordinates for d1d8tb2.
(The format of our PDB-style files is described here.)

Timeline for d1d8tb2: