Lineage for d4ogqb_ (4ogq B:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255813Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2255814Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2255815Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2255875Protein automated matches [254659] (2 species)
    not a true protein
  7. 2255879Species Nostoc sp. [TaxId:103690] [255732] (2 PDB entries)
  8. 2255880Domain d4ogqb_: 4ogq B: [257250]
    Other proteins in same PDB: d4ogqa_, d4ogqf_, d4ogqh_
    automated match to d2zt9b_
    complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, umq

Details for d4ogqb_

PDB Entry: 4ogq (more details), 2.5 Å

PDB Description: internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d4ogqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogqb_ f.32.1.1 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
athkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpam
tgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkfq
npfrrpvattvflfgtlvtlwlgigaalpldksltlglf

SCOPe Domain Coordinates for d4ogqb_:

Click to download the PDB-style file with coordinates for d4ogqb_.
(The format of our PDB-style files is described here.)

Timeline for d4ogqb_: