![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein automated matches [254659] (2 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [255732] (2 PDB entries) |
![]() | Domain d4ogqb_: 4ogq B: [257250] Other proteins in same PDB: d4ogqa_, d4ogqf_, d4ogqh_ automated match to d2zt9b_ complexed with 1o2, 2wa, 2wd, 2wm, 3wm, 7ph, 8k6, bcr, cd, cla, fes, hem, mys, oct, opc, sqd, umq |
PDB Entry: 4ogq (more details), 2.5 Å
SCOPe Domain Sequences for d4ogqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ogqb_ f.32.1.1 (B:) automated matches {Nostoc sp. [TaxId: 103690]} athkkpdlsdptlraklakgmghnyygepawpndllyvfpivimgsfacivalavldpam tgepanpfatpleilpewylypvfqilrslpnkllgvlamasvplglilvpfienvnkfq npfrrpvattvflfgtlvtlwlgigaalpldksltlglf
Timeline for d4ogqb_: