SCOPe 2.08: Domain d4o6za1: 4o6z A:1-442

Lineage for d4o6za1 (4o6z A:1-442)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [189486] (2 PDB entries)

8. Domain d4o6za1: 4o6z A:1-442 [257233]
   Other proteins in same PDB: d4o6za2, d4o6zb2, d4o6zd2
   automated match to d3ou5a_
   complexed with plp, po4

Details for d4o6za1

PDB Entry: 4o6z, 2.98 Å

PDB Description: crystal structure of serine hydroxymethyltransferase with covalently bound plp schiff-base from plasmodium falciparum

PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4o6za1:

Sequence; same for both SEQRES and ATOM records:

>d4o6za1 c.67.1.0 (A:1-442) automated matches {Plasmodium falciparum [TaxId: 36329]}
mfnndplqkydkelfdllekeknrqietinliasenltntavreclgdrisnkysegyph
kryyggndyvdkieelcykraleafnvseeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdlfesklykcnsegyvdmesvrnlalsfqpkviic
gytsyprdidykgfreicdevnaylfadishissfvacnllnnpftyadvvtttthkilr
gprsaliffnkkrnpgidqkinssvfpsfqggphnnkiaavacqlkevntpefkeytkqv
llnskalaecllkrnldlvtngtdnhlivvdlrkynitgsklqetcnainialnkntips
dvdcvspsgirigtpalttrgckekdmefiadmllkailltdelqqkygkklvdfkkglv
nnpkidelkkevvqwaknlpfa

Timeline for d4o6za1:

• d4o6za1 first appeared in SCOPe 2.04, called d4o6za_
  
• d4o6za1 appears in SCOPe 2.07