Lineage for d4o58a_ (4o58 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531245Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)
  8. 1531423Domain d4o58a_: 4o58 A: [257223]
    Other proteins in same PDB: d4o58b_, d4o58l1, d4o58l2
    automated match to d3sdya_
    complexed with nag, peg, so4

Details for d4o58a_

PDB Entry: 4o58 (more details), 2.75 Å

PDB Description: crystal structure of broadly neutralizing antibody f045-092 in complex with a/victoria/3/1975 (h3n2) influenza hemagglutinin
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4o58a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o58a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlid
allgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwt
gvtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstd
keqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsn
gnliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpe

SCOPe Domain Coordinates for d4o58a_:

Click to download the PDB-style file with coordinates for d4o58a_.
(The format of our PDB-style files is described here.)

Timeline for d4o58a_:

  • d4o58a_ appears in periodic updates to SCOPe 2.04 starting on 2014-07-19
  • d4o58a_ appears in SCOPe 2.05
  • d4o58a_ appears in the current release, SCOPe 2.07, called d4o58a1