SCOPe 2.08: Domain d4o3ab1: 4o3a B:3-263

Lineage for d4o3ab1 (4o3a B:3-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)

8. Domain d4o3ab1: 4o3a B:3-263 [257214]
   Other proteins in same PDB: d4o3aa2, d4o3ab2, d4o3ac2
   automated match to d1mm6a_
   complexed with act, asp, cl, gol, peg, zn

Details for d4o3ab1

PDB Entry: 4o3a, 1.8 Å

PDB Description: crystal structure of the glua2 ligand-binding domain in complex with l-aspartate at 1.80 a resolution

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d4o3ab1:

Sequence; same for both SEQRES and ATOM records:

>d4o3ab1 c.94.1.1 (B:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecgs

Timeline for d4o3ab1:

• d4o3ab1 first appeared in SCOPe 2.04, called d4o3ab_
  
• d4o3ab1 appears in SCOPe 2.07