SCOPe 2.06: Domain d4o1ta_: 4o1t A:

Lineage for d4o1ta_ (4o1t A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109625] (30 PDB entries)
   Uniprot Q9ER97

8. Domain d4o1ta_: 4o1t A: [257210]
   automated match to d1oj6b_
   complexed with hem, so4; mutant

Details for d4o1ta_

PDB Entry: 4o1t, 1.6 Å

PDB Description: Crystal structure of murine neuroglobin mutant F106W

PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d4o1ta_:

Sequence; same for both SEQRES and ATOM records:

>d4o1ta_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlsswstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

Timeline for d4o1ta_:

• d4o1ta_ first appeared in SCOPe 2.04
  
• d4o1ta_ appears in SCOPe 2.05
  
• d4o1ta_ appears in SCOPe 2.07
  
• d4o1ta_ appears in the current release, SCOPe 2.08