Lineage for d1efca2 (1efc A:297-393)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464914Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464915Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 464916Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (4 proteins)
  6. 464928Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 464934Species Escherichia coli [TaxId:562] [50468] (5 PDB entries)
  8. 464935Domain d1efca2: 1efc A:297-393 [25720]
    Other proteins in same PDB: d1efca1, d1efca3, d1efcb1, d1efcb3

Details for d1efca2

PDB Entry: 1efc (more details), 2.05 Å

PDB Description: intact elongation factor from e.coli

SCOP Domain Sequences for d1efca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efca2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOP Domain Coordinates for d1efca2:

Click to download the PDB-style file with coordinates for d1efca2.
(The format of our PDB-style files is described here.)

Timeline for d1efca2: