SCOP 1.55: Domain d1efca2: 1efc A:297-393

Lineage for d1efca2 (1efc A:297-393)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)

4. Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family)

5. Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (4 PDB entries)

8. Domain d1efca2: 1efc A:297-393 [25720]
   Other proteins in same PDB: d1efca1, d1efca3, d1efcb1, d1efcb3

Details for d1efca2

PDB Entry: 1efc, 2.05 Å

PDB Description: intact elongation factor from e.coli

SCOP Domain Sequences for d1efca2:

Sequence; same for both SEQRES and ATOM records:

>d1efca2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

Timeline for d1efca2:

• d1efca2 appears in SCOP 1.57
  
• d1efca2 appears in the current release, SCOPe 2.08