SCOPe 2.06: Domain d4ny8a2: 4ny8 A:92-148

Lineage for d4ny8a2 (4ny8 A:92-148)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)

8. Domain d4ny8a2: 4ny8 A:92-148 [257199]
   Other proteins in same PDB: d4ny8a1, d4ny8a3
   automated match to d4klia2
   protein/DNA complex; complexed with 0kx, mn, na

Details for d4ny8a2

PDB Entry: 4ny8, 2.25 Å

PDB Description: DNA polymerase beta with O6mG in the template base opposite to incoming non-hydrolyzable CTP with manganese in the active site

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d4ny8a2:

Sequence; same for both SEQRES and ATOM records:

>d4ny8a2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d4ny8a2:

• d4ny8a2 first appeared in SCOPe 2.04
  
• d4ny8a2 appears in SCOPe 2.05
  
• d4ny8a2 appears in SCOPe 2.07
  
• d4ny8a2 appears in the current release, SCOPe 2.08