Lineage for d4nxsb2 (4nxs B:324-422)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555976Protein Melibiase [75020] (4 species)
  7. 1555980Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
    alpha-galactosidase A
  8. 1556002Domain d4nxsb2: 4nxs B:324-422 [257197]
    Other proteins in same PDB: d4nxsa1, d4nxsb1
    automated match to d1r46b1
    complexed with 2oz, nag, so4

Details for d4nxsb2

PDB Entry: 4nxs (more details), 2.55 Å

PDB Description: crystal structure of human alpha-galactosidase a in complex with 1- deoxygalactonojirimycin-pfpht
PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d4nxsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nxsb2 b.71.1.1 (B:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq

SCOPe Domain Coordinates for d4nxsb2:

Click to download the PDB-style file with coordinates for d4nxsb2.
(The format of our PDB-style files is described here.)

Timeline for d4nxsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nxsb1