SCOPe 2.08: Domain d4nxsb2: 4nxs B:324-422

Lineage for d4nxsb2 (4nxs B:324-422)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Melibiase [75020] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries)
   alpha-galactosidase A

8. Domain d4nxsb2: 4nxs B:324-422 [257197]
   Other proteins in same PDB: d4nxsa1, d4nxsb1
   automated match to d1r46b1
   complexed with 2oz, nag, so4

Details for d4nxsb2

PDB Entry: 4nxs, 2.55 Å

PDB Description: crystal structure of human alpha-galactosidase a in complex with 1- deoxygalactonojirimycin-pfpht

PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d4nxsb2:

Sequence; same for both SEQRES and ATOM records:

>d4nxsb2 b.71.1.1 (B:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq

Timeline for d4nxsb2:

• d4nxsb2 first appeared in SCOPe 2.04
  
• d4nxsb2 appears in SCOPe 2.07