| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Melibiase [75020] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101919] (21 PDB entries) alpha-galactosidase A |
| Domain d4nxsb2: 4nxs B:324-422 [257197] Other proteins in same PDB: d4nxsa1, d4nxsb1 automated match to d1r46b1 complexed with 2oz, nag, so4 |
PDB Entry: 4nxs (more details), 2.55 Å
SCOPe Domain Sequences for d4nxsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nxsb2 b.71.1.1 (B:324-422) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentmq
Timeline for d4nxsb2: