Class b: All beta proteins [48724] (141 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (2 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
Protein Ribosomal protein L3 [50462] (1 species) superfamily fold is elaborated with additional structures |
Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (18 PDB entries) |
Domain d1ffkb_: 1ffk B: [25719] Other proteins in same PDB: d1ffkd_, d1ffky_ CA-atoms only complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkb_ b.43.3.2 (B:) Ribosomal protein L3 {Archaeon Haloarcula marismortui} pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns pregmetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhdp daaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhaldi vedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlgp wnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgsv pgpdkrlvpffrpavrpndqprldpevryvsnesnqg
Timeline for d1ffkb_: