Lineage for d4np4m1 (4np4 M:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512990Domain d4np4m1: 4np4 M:1-107 [257174]
    Other proteins in same PDB: d4np4m2
    automated match to d1dn0a1

Details for d4np4m1

PDB Entry: 4np4 (more details), 2.89 Å

PDB Description: clostridium difficile toxin b crop domain in complex with fab domains of neutralizing antibody bezlotoxumab
PDB Compounds: (M:) bezlotoxumab light chain

SCOPe Domain Sequences for d4np4m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4np4m1 b.1.1.1 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsstwtfgqgtkvei

SCOPe Domain Coordinates for d4np4m1:

Click to download the PDB-style file with coordinates for d4np4m1.
(The format of our PDB-style files is described here.)

Timeline for d4np4m1: