SCOPe 2.05: Domain d1efga1: 1efg A:283-403

Lineage for d1efga1 (1efg A:283-403)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)

8. Domain d1efga1: 1efg A:283-403 [25711]
   Other proteins in same PDB: d1efga2, d1efga3, d1efga4
   complexed with gdp

Details for d1efga1

PDB Entry: 1efg, 2.7 Å

PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1efga1:

Sequence; same for both SEQRES and ATOM records:

>d1efga1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e

Timeline for d1efga1:

• d1efga1 first appeared (with stable ids) in SCOP 1.55
  
• d1efga1 appears in SCOPe 2.04
  
• d1efga1 appears in SCOPe 2.06
  
• d1efga1 appears in the current release, SCOPe 2.08