Lineage for d1efga1 (1efg A:283-403)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111320Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 111321Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 111331Protein Elongation factor G (EF-G), domain II [50456] (1 species)
  7. 111332Species Thermus thermophilus [TaxId:274] [50457] (5 PDB entries)
  8. 111337Domain d1efga1: 1efg A:283-403 [25711]
    Other proteins in same PDB: d1efga2, d1efga3, d1efga4

Details for d1efga1

PDB Entry: 1efg (more details), 2.7 Å

PDB Description: the crystal structure of elongation factor g complexed with gdp, at 2.7 angstroms resolution

SCOP Domain Sequences for d1efga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efga1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e

SCOP Domain Coordinates for d1efga1:

Click to download the PDB-style file with coordinates for d1efga1.
(The format of our PDB-style files is described here.)

Timeline for d1efga1: