SCOP 1.71: Domain d1elo_1: 1elo 283-399

Lineage for d1elo_1 (1elo 283-399)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (3 families)

5. Family b.43.3.1: Elongation factors [50448] (9 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50457] (6 PDB entries)

8. Domain d1elo_1: 1elo 283-399 [25710]
   Other proteins in same PDB: d1elo_2, d1elo_3, d1elo_4

Details for d1elo_1

PDB Entry: 1elo, 2.85 Å

PDB Description: elongation factor g without nucleotide

SCOP Domain Sequences for d1elo_1:

Sequence; same for both SEQRES and ATOM records:

>d1elo_1 b.43.3.1 (283-399) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvil

Timeline for d1elo_1:

• d1elo_1 first appeared (with stable ids) in SCOP 1.55
  
• d1elo_1 appears in SCOP 1.69
  
• d1elo_1 is called d1eloa1 in SCOP 1.73
  
• d1elo_1 appears in the current release, SCOPe 2.08, called d1eloa1