Lineage for d1elo_1 (1elo 283-399)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-key
Superfamily b.43.3: Translation proteins [50447] (2 families) 
Family b.43.3.1: Elongation factors [50448] (6 proteins) 
Protein Elongation factor G (EF-G), domain II [50456] (1 species) Species Thermus thermophilus [TaxId:274] [50457] (5 PDB entries) 
Domain d1elo_1: 1elo 283-399 [25710]
Other proteins in same PDB: d1elo_2, d1elo_3, d1elo_4
Details for d1elo_1
PDB Entry: 1elo (more details), 2.85 Å
PDB Description: elongation factor g without nucleotide
SCOP Domain Sequences for d1elo_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1elo_1 b.43.3.1 (283-399) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvil
SCOP Domain Coordinates for d1elo_1:
Click to download the PDB-style file with coordinates for d1elo_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1elo_1:
- d1elo_1 first appeared (with stable ids) in SCOP 1.55
- d1elo_1 appears in SCOP 1.61
- d1elo_1 appears in SCOP 1.65
- d1elo_1 appears in the current release, SCOPe 2.08, called d1eloa1
View in 3D
