SCOP 1.59: Domain d1fnma1: 1fnm A:283-403

Lineage for d1fnma1 (1fnm A:283-403)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.3: Translation proteins [50447] (2 families)

5. Family b.43.3.1: Elongation factors [50448] (4 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50457] (5 PDB entries)

8. Domain d1fnma1: 1fnm A:283-403 [25709]
   Other proteins in same PDB: d1fnma2, d1fnma3, d1fnma4, d1fnma5

Details for d1fnma1

PDB Entry: 1fnm, 2.8 Å

PDB Description: structure of thermus thermophilus ef-g h573a

SCOP Domain Sequences for d1fnma1:

Sequence; same for both SEQRES and ATOM records:

>d1fnma1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e

Timeline for d1fnma1:

• d1fnma1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnma1 appears in SCOP 1.57
  
• d1fnma1 appears in SCOP 1.61
  
• d1fnma1 appears in the current release, SCOPe 2.08