Lineage for d2efga1 (2efg A:283-401)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111320Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 111321Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 111331Protein Elongation factor G (EF-G), domain II [50456] (1 species)
  7. 111332Species Thermus thermophilus [TaxId:274] [50457] (5 PDB entries)
  8. 111334Domain d2efga1: 2efg A:283-401 [25708]
    Other proteins in same PDB: d2efga2, d2efga3, d2efga4

Details for d2efga1

PDB Entry: 2efg (more details), 2.6 Å

PDB Description: translational elongation factor g complexed with gdp

SCOP Domain Sequences for d2efga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2efga1 b.43.3.1 (A:283-401) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprviles

SCOP Domain Coordinates for d2efga1:

Click to download the PDB-style file with coordinates for d2efga1.
(The format of our PDB-style files is described here.)

Timeline for d2efga1: