SCOPe 2.04: Domain d4m81a_: 4m81 A:

Lineage for d4m81a_ (4m81 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (20 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [188406] (6 PDB entries)

8. Domain d4m81a_: 4m81 A: [257074]
   automated match to d3n9ka_
   complexed with glf, gol, pnw

Details for d4m81a_

PDB Entry: 4m81, 1.86 Å

PDB Description: the structure of e292s glycosynthase variant of exo-1,3-beta-glucanase from candida albicans complexed with 1-fluoro-alpha-d-glucopyranoside (donor) and p-nitrophenyl beta-d-glucopyranoside (acceptor) at 1.86a resolution

PDB Compounds: (A:) exo-1,3-beta-glucanase

SCOPe Domain Sequences for d4m81a_:

Sequence; same for both SEQRES and ATOM records:

>d4m81a_ c.1.8.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagswsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

Timeline for d4m81a_:

• d4m81a_ is new in SCOPe 2.04-stable
  
• d4m81a_ appears in SCOPe 2.05
  
• d4m81a_ appears in the current release, SCOPe 2.08