SCOPe 2.05: Domain d1dara1: 1dar A:283-400

Lineage for d1dara1 (1dar A:283-400)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor G (EF-G), domain II [50456] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)

8. Domain d1dara1: 1dar A:283-400 [25707]
   Other proteins in same PDB: d1dara2, d1dara3, d1dara4
   complexed with gdp

Details for d1dara1

PDB Entry: 1dar, 2.4 Å

PDB Description: elongation factor g in complex with gdp

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1dara1:

Sequence; same for both SEQRES and ATOM records:

>d1dara1 b.43.3.1 (A:283-400) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvile

Timeline for d1dara1:

• d1dara1 first appeared (with stable ids) in SCOP 1.55, called d1dar_1
  
• d1dara1 appears in SCOPe 2.04
  
• d1dara1 appears in SCOPe 2.06
  
• d1dara1 appears in the current release, SCOPe 2.08